Protein Info for GFF796 in Sphingobium sp. HT1-2

Annotation: Cobalt/zinc/cadmium resistance protein CzcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 59 to 79 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 55 to 316 (262 residues), 206 bits, see alignment E=3.8e-65 PF01545: Cation_efflux" amino acids 62 to 270 (209 residues), 128.2 bits, see alignment E=1.8e-41

Best Hits

KEGG orthology group: None (inferred from 82% identity to sjp:SJA_C1-01640)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF796 Cobalt/zinc/cadmium resistance protein CzcD (Sphingobium sp. HT1-2)
MHDDHAHGHHHHGAGCSHDHAHHPAPAAPPPIDKDGEERHYFDHIYLSAGHDKNARRTLW
VVWLTAATMVVEIAFGWITGSMALLADGFHMATHAGALAVAAAAYSYAKRHARNPRYTFG
TGKVGDLSGFASALLLLLTALFIAIESGMRLFEPVKVAFGEATLVAVVGLVINLVSALLL
GHDHSHDHGHSHAHDDHDHDHKGGHADNNLRAAYVHVLTDALTSVLAIAALLAGRYLGWW
WLDPAVGLLGAVVIARWAWGLMKDTAAILLDTAEPALMARVRGLVEAEGATIRDLHVWRI
GPHAHAAIISLAPGADGARVRERVRSLPRMEHVTVECG