Protein Info for GFF7959 in Variovorax sp. SCN45

Annotation: Ferrous iron transporter FeoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details PF07664: FeoB_C" amino acids 26 to 78 (53 residues), 59.8 bits, see alignment E=1.7e-20 PF07670: Gate" amino acids 84 to 163 (80 residues), 46.3 bits, see alignment E=5.1e-16

Best Hits

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>GFF7959 Ferrous iron transporter FeoB (Variovorax sp. SCN45)
VYALLIGAFIPQQKVWGAFNLQGLVLFGLYMAGIVSALMVSWVMKKWRRDKSEHPLLLEL
PSYRIPHLRDLAIGLWERAWIFLRRVGGIILALTILLWFLLSFPGAPEGATQPAIDYSFA
GRIGHALSAVFAPIGFNWQICIALIPGLAAREVAVSSLATVYALSAADDD