Protein Info for PS417_04015 in Pseudomonas simiae WCS417

Annotation: choline ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 37 to 210 (174 residues), 79 bits, see alignment E=2e-26

Best Hits

Swiss-Prot: 65% identical to OSMW_SALTY: Osmoprotectant import permease protein OsmW (osmW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 96% identity to pfo:Pfl01_0804)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUT0 at UniProt or InterPro

Protein Sequence (217 amino acids)

>PS417_04015 choline ABC transporter permease (Pseudomonas simiae WCS417)
MEFLNAFSHLDWAQVLQLTGQHITLVGIAVILAILIGVPLGILMTRFPTLAGPLQASATV
LLTVPSIALFGLLLPFYSKFGQGLGPMPAITAVFLYSLLPIMRNTYLALTGVEPGIREAA
RGIGMTFGQRLRMVELPIAVPVILAGVRTAVVMNIGVMTIAATIGAGGLGVLILASISRS
DMSMLIVGAVLVSLLAIFADLLLQWLQRSLTPKGLLK