Protein Info for GFF786 in Xanthobacter sp. DMC5

Annotation: Bicarbonate transport system permease protein CmpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 193 to 208 (16 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 273 (169 residues), 75.1 bits, see alignment E=3.2e-25

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 72% identity to azc:AZC_2278)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF786 Bicarbonate transport system permease protein CmpB (Xanthobacter sp. DMC5)
LNAEPQRRSFTAGADPTTGARPKGAARGGGLSRPLLGIAGLLVLLALWWLGTDVLAAPGS
FARRFSPASAFASLGGLLLHSDLPIHVYVSLQRIFIGLGFALAIGVPLGLAVGTFGALEA
ATTPAFQFLRMISPLSWMPLAVMVFGVGDRPIYFLLAFAAVWPILLSTAAGVRQLDPRWL
LLARSLAATRWEMLSRVILPGVTGHILTGVRLAIGILWIVLVPCEMLGVSAGLGYFILDT
RDRLAYSELMAMVLLIGVLGFALDALARALCRRWA