Protein Info for GFF784 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 190 to 234 (45 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 272 (169 residues), 86.8 bits, see alignment E=7.9e-29

Best Hits

Swiss-Prot: 47% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 51% identity to tcu:Tcur_1374)

MetaCyc: 47% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF784 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MTHAAPASIFPAAGKIALKRTPRQRESRLRLAGADATRLVLPLALLAIWQGACSFGFISP
RTLESPVAVVGALVELTLSGVLWESLVASFKRASAGFLVGGGLGLVLGIVAGLWRTGERA
YDALLQMLRMVPFLAVIPLFVIWFGVDEEPKVLLIALACIFPVYLNTFSGVRNVDPKIIE
AATVFGMSRAAIATEIVAPLALPSIMVGVRYAMGVALLSLVAAEQVNATSGIGYLALNPR
ASLRTDIILGVVLLYSVLGLAVDFLIRTAQSRLLPWHRSVLEKAR