Protein Info for GFF7816 in Variovorax sp. SCN45

Annotation: MarC family integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details PF01914: MarC" amino acids 2 to 159 (158 residues), 123.5 bits, see alignment E=4e-40

Best Hits

Swiss-Prot: 49% identical to YHGN_SHIFL: UPF0056 inner membrane protein YhgN (yhgN) from Shigella flexneri

KEGG orthology group: None (inferred from 86% identity to xca:xccb100_1663)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>GFF7816 MarC family integral membrane protein (Variovorax sp. SCN45)
PKRQRIVLARELLIALGVLMLFLWGGKYALELMHLRQESVSIAGGIVLFLIGIRMIFPPP
EGLMGEIPDGEPFIVPMAIPLVAGPSGMAAVMLMGSNDPARLGDWSLALMIAWGATAAIL
FSATILYKLLGRRALIAIERLMGMLLVAISVQMILDGLGAYLPGPP