Protein Info for GFF779 in Xanthobacter sp. DMC5

Annotation: Alpha-ketoglutarate-dependent sulfate ester dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF02668: TauD" amino acids 21 to 294 (274 residues), 213 bits, see alignment E=3.8e-67

Best Hits

Swiss-Prot: 53% identical to ATSK_ACIAD: Alkylsulfatase (atsK) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03119, taurine dioxygenase [EC: 1.14.11.17] (inferred from 69% identity to rlt:Rleg2_5751)

Predicted SEED Role

"Alpha-ketoglutarate-dependent taurine dioxygenase (EC 1.14.11.17)" in subsystem Alkanesulfonate assimilation or Taurine Utilization (EC 1.14.11.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.17

Use Curated BLAST to search for 1.14.11.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>GFF779 Alpha-ketoglutarate-dependent sulfate ester dioxygenase (Xanthobacter sp. DMC5)
MSASISTLPNTPEPAIPESDILPLSGRIGVEIRNVRLAGDLPQPLFDEVHRLLLKHKALF
FRDQHHLDDAAQEAFGARFGGLVPHPTIGALAGTSSVLELDTRRTGERDSGQGAGRADQW
HTDVTFVDAYPKISVLRGVVIPAAGGDTVWSNTAAVYDRLPEPLRQLADSLWATHSNAYD
YAAVRPHATDDDRRQFNRNFTKTVFETDHPVVRVHPETGERSLVLGNFVQRFVGLNKGDS
QKLYDLFQSHITAPENTVRWRWRAGDVAIWDNRSTQHYAVNDYGDAHRVVRRVTVDGEVP
VSVDGRTSVTRNRFDKPADRAA