Protein Info for PS417_03960 in Pseudomonas simiae WCS417

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR02417: D-fructose-responsive transcription factor" amino acids 2 to 327 (326 residues), 451.3 bits, see alignment E=1e-139 PF00356: LacI" amino acids 3 to 50 (48 residues), 56.8 bits, see alignment 3.1e-19 PF00532: Peripla_BP_1" amino acids 62 to 246 (185 residues), 70.3 bits, see alignment E=4.1e-23 PF13407: Peripla_BP_4" amino acids 65 to 279 (215 residues), 59.5 bits, see alignment E=8.1e-20

Best Hits

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 97% identity to pfs:PFLU0803)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFU6 at UniProt or InterPro

Protein Sequence (331 amino acids)

>PS417_03960 transcriptional regulator (Pseudomonas simiae WCS417)
MKLSDIARLAGVSVTTASYVINGKAEQQRISNATVERVRAVVEAHGFTPNPQAAGLRSRH
TRTLGFILPDLENPSYARIAKLLEQGARARGYQLLIASSDDDADSERQLLQLFRARRCDA
LFVASCLPASDDSYRELQAKGLPVIAIDRVMGADQFCSVVSDDRQACLQLTSSLLQPLPK
QIVLIGARPELSISQERAAGFREALEGFTGEVIVEHGEAFSRDCGRQLMEQLLQQLGHLP
DALVTTSYVLLQGVFDALHDFPLKSRPLRLGTFGDTQLLDFLPLPVNAMAQQHQLIAETA
LRLALVAVEDEQYQPGVHAIGRTFKQRIREA