Protein Info for GFF776 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 267 (170 residues), 56.8 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 65% identity to rsq:Rsph17025_0749)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF776 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MSIEAAAATTLPAEARASTTLRTVTRRIDWRPWTAFAALLALWFAAHHFGWVPAKYLPSP
LAVVQRLIREVTAGTLLHDLHDTLRRNLSGLVIGVAAGLALGALLGASSLVGRIVGPTVL
AQRQTALFAWVPLLAMWFGGGDTGKITFIAVAAFQPVVIGTWRGISLVPATFRELSDVLL
LSRWNYMRLVALPHALPMIFTGLHGALIYAWLATVGSELFLNISPGLGGRLNEGSQLFEI
DLLFLVILLFGLIGLGFNTLAERAEGLLIRWNNR