Protein Info for GFF7737 in Variovorax sp. SCN45

Annotation: L-threonine kinase in B12 biosynthesis (EC 2.7.1.177)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Predicted SEED Role

"Threonine kinase in B12 biosynthesis" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis or Propanediol utilization

MetaCyc Pathways

superpathway of L-threonine metabolism (14/18 steps found)
aminopropanol phosphate biosynthesis I (2/2 steps found)
adenosylcobalamin biosynthesis II (aerobic) (23/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (22/36 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>GFF7737 L-threonine kinase in B12 biosynthesis (EC 2.7.1.177) (Variovorax sp. SCN45)
DKCRRAIEAYLRLHGKSLPPGRFSHDSELPVGKGMASSTADVVATVRCLDRVFALHTPLD
ALTELLRGIERSDSVFLDRYALYLSGRQRVLREFGPAPRLHACYIDEGGTVETEKLAEPL
LQHYHRHQSSYRVHLELALEAFERSDAAAICEVATRSAQLAQWVTPKPHLDMMLRHRREL
GADGVVVAHTGSLIGY