Protein Info for GFF7722 in Variovorax sp. SCN45

Annotation: NAD(P)H steroid dehydrogenase-like protein in alkane synthesis cluster

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF04321: RmlD_sub_bind" amino acids 9 to 193 (185 residues), 50.2 bits, see alignment E=8e-17 PF05368: NmrA" amino acids 10 to 123 (114 residues), 33.8 bits, see alignment E=1.2e-11 PF01370: Epimerase" amino acids 11 to 195 (185 residues), 98.5 bits, see alignment E=1.7e-31 PF02719: Polysacc_synt_2" amino acids 11 to 119 (109 residues), 30.6 bits, see alignment E=8.2e-11 PF01073: 3Beta_HSD" amino acids 12 to 195 (184 residues), 128.7 bits, see alignment E=8.9e-41 PF16363: GDP_Man_Dehyd" amino acids 12 to 158 (147 residues), 41.2 bits, see alignment E=6.2e-14 PF13460: NAD_binding_10" amino acids 15 to 156 (142 residues), 54.9 bits, see alignment E=4.4e-18 PF07993: NAD_binding_4" amino acids 67 to 178 (112 residues), 46.4 bits, see alignment E=1.2e-15

Best Hits

Predicted SEED Role

"NAD(P)H steroid dehydrogenase-like protein in alkane synthesis cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>GFF7722 NAD(P)H steroid dehydrogenase-like protein in alkane synthesis cluster (Variovorax sp. SCN45)
SPLLEPNAMKILVTGGGGFLGQALCRGLVARGHEVVSFNRGHYPALDPLGVTQIQGDLAD
RDAVVAAAQGCEAIFHNAAKAGAWGSYESYHQANVVGTENVLAACRAHGIGKLIYTSTPS
VTHRATNPVEGGSAETVPYGDGFKAAYATTKTIAEKAVLAANSPQLATVALRPRLIWGVG
DNQLLPRLVQRANSGRLR