Protein Info for PS417_03925 in Pseudomonas simiae WCS417

Annotation: nicotinate-nucleotide pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 17 to 279 (263 residues), 311.7 bits, see alignment E=1.9e-97 PF02749: QRPTase_N" amino acids 29 to 113 (85 residues), 73.5 bits, see alignment E=1.3e-24 PF01729: QRPTase_C" amino acids 115 to 279 (165 residues), 191 bits, see alignment E=1.4e-60

Best Hits

Swiss-Prot: 77% identical to NADC_PSEAE: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 99% identity to pfs:PFLU0796)

MetaCyc: 54% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZI9 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PS417_03925 nicotinate-nucleotide pyrophosphorylase (Pseudomonas simiae WCS417)
MPNLRLADLTAEIEANVRRALLEDIGSGDITAQLIPAERLATATIITRDTAVIAGTAWVD
AVFRQLDPRVAVHWQVADGERVSPNQVLFRLEGPARSLLSGERCALNFLQLLSGVATRAQ
FLADFVASTQVKLLDTRKTLPGLRLAQKYAVTCGGCHNHRIGLYDAFLIKENHIAACGGI
AQAITAAHKIAPGKPVEIEVESLDELREALAAGADIIMLDELSLDDMREAVRLNGGKAKL
EASGGINESTLLPIAETGVDYISIGAMTKDVKAVDLSMRLSI