Protein Info for GFF772 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 325 to 351 (27 residues), see Phobius details amino acids 382 to 413 (32 residues), see Phobius details amino acids 426 to 447 (22 residues), see Phobius details PF13347: MFS_2" amino acids 35 to 451 (417 residues), 247.6 bits, see alignment E=1.9e-77

Best Hits

Predicted SEED Role

"FIG097052: Sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>GFF772 hypothetical protein (Sphingobium sp. HT1-2)
MATLPYADYLDDRSITRPEPARVGEGEPSRLRLTGFASIAVPIAGAGLPLALFVPQLYAT
QFGLSLATIGFIFLLGRIWDVSADPLVGALSDRTRSRFGRRRPWIAAGGLLFGLSSALLF
FPPAALVTPAYLGAALFFFYLGWSMIEIPASAWAGELSRHYHGRTRVVSYQALLRAIGLL
AVLVLPTILDQVEPGNGTLKLQLVGGFIIATLIPSLALTLFSVPEPPVPATPPVRPSFWR
ATSVIFSDRLLLRVLASDAVVTAGQSIRASLIVFFAVWYMGLPAWASGLYLLQFIFGVAA
APIWLRIGTRIGKRQAAISGEIAQAAINIGLLFVFPGGLPLLLALTIAQGLTQGSGNLML
RAMVADVADAHRLRTGHDRTGLFFSVFALSAKLGPAIGIGIALPLIAWLGFAAGPHNSPS
ALEGLKTVFALGPALAHIIATLIIWRFPLDEAAHAEIRRALDQRDAIPA