Protein Info for GFF771 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 198 to 224 (27 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 274 (169 residues), 96.3 bits, see alignment E=9.7e-32

Best Hits

Swiss-Prot: 36% identical to Y413_METJA: Putative ABC transporter permease protein MJ0413 (MJ0413) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 89% identity to xau:Xaut_3459)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>GFF771 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MSHTSDTIEAAAVEAATVDLPAHAEAPGRRGLQLPNLTGFILPFIILVLWQTAATYKWID
PVFLPAPLTVVTAFWKMLTKQKLAFDFLASINIVGQAFIYGSAAALLLGIAAGLSRKVEE
FFGPTFDTIRHIPGIAWLPLIVLWLGIGAPAKILVIAKSVFFPVFLNTLQGIRNVEKNYI
ELAKVLTLTRWQLIRKVILPAAMPSIMVSLRYAAGLAWALVVVAEGLSGLEGLGFLIFRA
QGLLLTDQLLVCMVIIGLVGFAIDRSMFLAQKRVLKWKQGYDG