Protein Info for PS417_00390 in Pseudomonas simiae WCS417

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01297: ZnuA" amino acids 27 to 300 (274 residues), 219.8 bits, see alignment E=2.5e-69

Best Hits

Swiss-Prot: 40% identical to ZNUA_ECOLI: High-affinity zinc uptake system protein ZnuA (znuA) from Escherichia coli (strain K12)

KEGG orthology group: K09815, zinc transport system substrate-binding protein (inferred from 97% identity to pfs:PFLU0076)

MetaCyc: 40% identical to Zn2+ ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U334 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PS417_00390 ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MSRLFPVFVVFVTSLFITGAAQAEVKVLTSIKPLQLIAAAVQDGVAVPEVLLPPGASPHN
YALRPSDVRRVQSVDLLYWIGPDMESFLPRVLKGRTATTVAVQDLPGMKLRRFAEDNHSH
ADDADEHDHDHRPGSLDAHLWLSTVNARVIAARMAADLAAADPANAARYQSNAKAFDERL
DALDARLKARLAPIDGKPYFVFHEAFDYFEEAYGLKHAGVFSVAAEVQPGAQHVAAMRTR
LQEVGKTCVFSEPPLRPRLAETLVSGLPVKLAELDALGGYTPATAQGYEQVLEKLGNDLA
GCLESL