Protein Info for GFF7698 in Variovorax sp. SCN45

Annotation: Na+-driven multidrug efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details PF01554: MatE" amino acids 6 to 57 (52 residues), 25.9 bits, see alignment E=3.6e-10 amino acids 127 to 191 (65 residues), 46.7 bits, see alignment E=1.5e-16

Best Hits

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF7698 Na+-driven multidrug efflux pump (Variovorax sp. SCN45)
AWSIENGYRYTQWMLGSNAVIMLLFVINAILRGAGDAAISMRVLWLSNGLNIVLCPLLIF
GPGPFPALGIEGAAIATCIGRGTGVLYQLWALFRGGTHIRVTMAQLAWRGAMLWNIVRTS
LGGIGQMIVAMTAWIFLMRILATIGSEAVAGATIAIRIMMFTMMPAWGMSNAAATLVGQN
LGAGHADRAAVDEQRRRVAVQVD