Protein Info for GFF7660 in Variovorax sp. SCN45

Annotation: Protein translocase subunit SecY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details PF00344: SecY" amino acids 78 to 183 (106 residues), 111.7 bits, see alignment E=2.3e-36

Best Hits

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>GFF7660 Protein translocase subunit SecY (Variovorax sp. SCN45)
MARSGNAMAGIGGGLGKFTELRQRLLFVIGALIVYRIGSYITVPGINPEAMVKFMETKQG
TIVDMFNMFSGGALHRFSLFALNVMPYISASIIVQLLVQIVPSLKAIQKEGESGRRMINQ
WSRMGAIPLAVFQAWGIAAGLQSSVAPDGVPVVYAPGMGFILTAVIALTAGTMFLMWLGE
QIT