Protein Info for GFF766 in Xanthobacter sp. DMC5

Annotation: 3-mercaptopropionate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05995: CDO_I
  • amino acids 66 to 176 (111 residues), 26.3 bits, E=2.5e-10

Best Hits

Swiss-Prot: 65% identical to 3MDO_PSEAE: 3-mercaptopropionate dioxygenase (PA2602) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 71% identity to rme:Rmet_2216)

MetaCyc: 54% identical to 3-mercaptopropionate dioxygenase (Advenella mimigardefordensis DPN7)
RXN-15364 [EC: 1.13.11.91]

Predicted SEED Role

"Cysteine dioxygenase (EC 1.13.11.20)" (EC 1.13.11.20)

MetaCyc Pathways

• L-cysteine degradation I (2/3 steps found)
• 3,3'-disulfanediyldipropannoate degradation (2/4 steps found)
• taurine biosynthesis I (1/3 steps found)
• 3,3'-thiodipropanoate degradation (1/4 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.20 or 1.13.11.91

Protein Sequence (212 amino acids)

>GFF766 3-mercaptopropionate dioxygenase (Xanthobacter sp. DMC5)
MTTPKSALAPTDAAPIAPLRDFVVAFGRLLDERPDEARILTDGAPLLARLVSRDNWLPAA
YAAPHPTYYQQHLLHADSTERFSIVSFVWGPGQKTPVHDHTVWGLIGMLRGAEYNQPYVL
DDEGRPRPSGDPDRLEPGAVAAVSPTIGDLHRVSNAFDDRVSISIHVYGANIGGVHRHTY
PEDGPPKPFVSGYSNTTLPNLWDRSKDGRRST