Protein Info for PS417_03890 in Pseudomonas simiae WCS417

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 9 to 185 (177 residues), 230.2 bits, E=7.5e-73
• TIGR00152: dephospho-CoA kinase
  • amino acids 10 to 193 (184 residues), 182 bits, E=5.4e-58

Best Hits

Swiss-Prot: 85% identical to COAE_PSEPF: Dephospho-CoA kinase (coaE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 96% identity to pfs:PFLU0789)

MetaCyc: 52% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See A0A1N7U1Y4 at UniProt or InterPro

Protein Sequence (207 amino acids)

>PS417_03890 dephospho-CoA kinase (Pseudomonas simiae WCS417)
MTTPVTTPWILGLTGGIGSGKSAAAQHFIDLGIDLVDADHAARWVVEPGRPALARIAEHF
GAGVLHPDGQLNRAALRKLIFEEPEERRWLEALLHPLIGEEIRSHLARAKSPYAILVSPL
LIESGQYSMTQRILVIDVPQSLQIQRTLQRDGINEQQVQAILKAQSSREDRLNHADDVLV
NDRDLAWLHSEVERLHHFYLTLRGGRS