Protein Info for GFF765 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868
Annotation: Putative phosphotransferase enzyme II, B component
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K02822, PTS system, ascorbate-specific IIB component [EC: 2.7.1.69] (inferred from 97% identity to ses:SARI_02045)Predicted SEED Role
"Putative phosphotransferase enzyme II, B component"
KEGG Metabolic Maps
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Fructose and mannose metabolism
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Nucleotide sugars metabolism
- Starch and sucrose metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.69
Use Curated BLAST to search for 2.7.1.69
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (106 amino acids)
>GFF765 Putative phosphotransferase enzyme II, B component (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868) MKDSVNILFVCGYGVGSSVMLQTVVKKALAKYDFSFDMEHTAAGEVGGFTDWADIYAISK KLLDVVSLDPKHGQYLIPIENIMDGESIGKQIYDVVEKNFPHLLNK