Protein Info for PS417_03885 in Pseudomonas simiae WCS417

Annotation: DNA gyrase inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 PF03884: YacG" amino acids 7 to 56 (50 residues), 85.7 bits, see alignment E=6.9e-29

Best Hits

Swiss-Prot: 97% identical to YACG_PSEFS: DNA gyrase inhibitor YacG (yacG) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K09862, hypothetical protein (inferred from 97% identity to pfs:PFLU0788)

Predicted SEED Role

"FIG003276: zinc-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TW18 at UniProt or InterPro

Protein Sequence (66 amino acids)

>PS417_03885 DNA gyrase inhibitor (Pseudomonas simiae WCS417)
MSQPLTVDCPTCGAPVEWKATNLNRPFCSDRCKLIDLGAWAAEEHKIPVAPDAEDELFSE
DLPPRH