Protein Info for GFF761 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putrescine transport system permease protein PotI (TC 3.A.1.11.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 64 to 90 (27 residues), see Phobius details amino acids 102 to 129 (28 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 273 (195 residues), 50.1 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 95% identical to POTI_ECOLI: Putrescine transport system permease protein PotI (potI) from Escherichia coli (strain K12)

KEGG orthology group: K11074, putrescine transport system permease protein (inferred from 98% identity to ses:SARI_02050)

MetaCyc: 95% identical to putrescine ABC transporter membrane subunit PotI (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotI (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>GFF761 Putrescine transport system permease protein PotI (TC 3.A.1.11.2) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNNLPVVRSPWRILILVLGFTFLYAPMLMLVIYSFNSSKLVTVWAGWSTRWYGELFRDTA
MMSAVGLSLTIAACAATMAVVLGTIAAVVMVRFGRFRGANGFAFMITAPLVMPDVITGLS
LLLLFVALGHAIGWPSDRGMLTIWLAHVTFCTAYVAVVIASRLRELDRSIEEAAMDLGAA
PLKVFFVITLPMIMPAVISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNP
EINALATLILGVVGIVGFIAWYLMARAEKQRIRDIQRARRG