Protein Info for GFF760 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF13365: Trypsin_2" amino acids 48 to 184 (137 residues), 114.1 bits, see alignment E=2.3e-36 PF00089: Trypsin" amino acids 48 to 204 (157 residues), 51.1 bits, see alignment E=4.1e-17 PF00595: PDZ" amino acids 221 to 298 (78 residues), 29.2 bits, see alignment E=2.5e-10 PF13180: PDZ_2" amino acids 239 to 303 (65 residues), 29 bits, see alignment E=2.6e-10 PF17820: PDZ_6" amino acids 249 to 295 (47 residues), 29.2 bits, see alignment 1.5e-10

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 48% identity to hhy:Halhy_1963)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF760 hypothetical protein (Variovorax sp. SCN45)
MGAREDEFLLDSYSATVTRVAHTASAAVAHIKVRKQPQRGNAGGQGSGSGFLFTPDGFAI
TNAHVVEGASELRAAFSDGTESPARLVGIDASTDVAVLRIESHTSAFLPLGSSAALQPGQ
LAVAVGNPLGFDFTVTAGIVSALGRSLPSRGGRMIEDVIQTDVALNPGNSGGPLLDSAAQ
VIGVNTAVIPSAQGLSFAVAIDTARWVAGELMRHGAVRRGKLGVQCAAMALPRRWVRENE
WSVGTGLRVVEVVAGSAAARDGLRSGDILIGCDGTPLAQLSDLLKRLAGEGYGRPLLLKL
LRPVAGTLTTLYLTVAPGG