Protein Info for GFF76 in Variovorax sp. SCN45

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 264 to 294 (31 residues), see Phobius details amino acids 315 to 339 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 176 to 340 (165 residues), 60.1 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 83% identity to del:DelCs14_0986)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF76 Alkanesulfonates transport system permease protein (Variovorax sp. SCN45)
MTTAERFIEAPRLPRAPSPVVAAAAAEAAPPRAAAGPGGLWATGLLAAAAWVALGLLTLL
WPNKEVGFSDWAFTREFGVAALVVAALLLAVSVLGARAGRLAQALRPAGQWLVALAVVLA
LWETFTAKLGLLPSPFFAPPQSLIDVVHEDWQRLGLSTAYSLRLLANGFVLGALVGFGTG
VAVGWSRIAGYWVHPLLRFLGPVPASALLPLAFFFAPSSYSAAVFLVGLATFFPVAVLTW
SGVASVGKSYYDVARTLGASERFLVLRVAIPAALPQVFVGLFMGLGASFSVLITAEMMGV
KAGLGWYLQWAQGWAAYANMYAALFVMAVLCSGLITLLFKVRDRVLSWQKGTVKW