Protein Info for GFF7591 in Variovorax sp. SCN45

Annotation: Phosphate ABC transporter, substrate-binding protein PstS (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF12849: PBP_like_2" amino acids 3 to 227 (225 residues), 135 bits, see alignment E=4.4e-43 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 11 to 231 (221 residues), 320.7 bits, see alignment E=4.6e-100 PF01547: SBP_bac_1" amino acids 13 to 227 (215 residues), 59 bits, see alignment E=8.2e-20

Best Hits

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>GFF7591 Phosphate ABC transporter, substrate-binding protein PstS (TC 3.A.1.7.1) (Variovorax sp. SCN45)
APAGDKVAAQITGAGATFIFPLLSKWSDDYNKATGAKVNYQSIGSGGGIAQIKAGTVDFG
SSDKPLPSDELAAAGLGQFPSAIGGVVPVVNVEGIDAGKLRLTGPLLADIFMGKIAKWND
AAIAAANPGTTLPDLKINVVHRSDGSGTTFNFSNYLSKVSPEWKTSVGEGTAVQWPTGIG
GKGNEGVAAYVKQIQGGIGYVELSYALQNKMAYSRLKNADGKFVLPTDETF