Protein Info for GFF7532 in Variovorax sp. SCN45

Annotation: Glycogen debranching enzyme (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF21331: Isoamylase_C" amino acids 1 to 103 (103 residues), 169.5 bits, see alignment E=1.2e-54

Best Hits

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>GFF7532 Glycogen debranching enzyme (EC 3.2.1.-) (Variovorax sp. SCN45)
KPDGAQADSAYFNGADNHALAWRIDGSEFGDSASAIYIAYNGWSGPVNFVLPWPGTGKQW
YRVTDTASWNEGPNAFAAPGSETLIGGENTTYGAQARSLFLLIAK