Protein Info for PS417_03815 in Pseudomonas simiae WCS417

Annotation: DNA transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 5 to 245 (241 residues), 275.9 bits, see alignment E=1.4e-86 PF13512: TPR_18" amino acids 27 to 166 (140 residues), 176.1 bits, see alignment E=4.8e-56 PF13525: YfiO" amino acids 30 to 233 (204 residues), 251.9 bits, see alignment E=4.8e-79

Best Hits

Swiss-Prot: 76% identical to BAMD_PSEAE: Outer membrane protein assembly factor BamD (bamD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05807, putative lipoprotein (inferred from 98% identity to pfs:PFLU0779)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1X8 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PS417_03815 DNA transporter (Pseudomonas simiae WCS417)
MQVKHLLLIAILAMTAACSSTKEVVDENLSEVELYQLAQKDLDNNSFTSATAKLKALESR
YPFGRYADQAQLELIYANYKNAEPEAAKSAAERFIRLHPQHPNVDYAYYMKGLTSFDQDV
GLLARFLPLDMTKRDPGAARDSYNEFAQLTSRYPNSRYAPDAKQRMIYLRNLLASYEIHV
AHYYLTRQAYVAAANRGRYVVENFQETPSVGDGLAVMTEAYQRLHLDELASTSLETLKLN
YPDHPSLKDGQFVPQVAEADNRSWLSKYTLGLIESRPPLPPGETRANQDVIKQYQDAKDA
IPSDLKPHDENGDVIEEEEPQALGNNQDRSWFSYMTFGVFD