Protein Info for GFF7509 in Variovorax sp. SCN45

Annotation: Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF02801: Ketoacyl-synt_C" amino acids 2 to 86 (85 residues), 101.8 bits, see alignment E=5e-33 PF16197: KAsynt_C_assoc" amino acids 89 to 206 (118 residues), 46.5 bits, see alignment E=8.7e-16 PF22621: CurL-like_PKS_C" amino acids 158 to 221 (64 residues), 47.7 bits, see alignment E=2.5e-16 PF22336: RhiE-like_linker" amino acids 161 to 227 (67 residues), 69.9 bits, see alignment E=2.8e-23

Best Hits

Predicted SEED Role

"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.39

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF7509 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) (Variovorax sp. SCN45)
TLARAGVGADQIGCVEAHGTGTAMGDPIEVEGLSQAFAATTADTGFCALGSVKSNIGHLE
AAAGVAGLTKVLLQFRHGELAPTLHSERPNPDLDLAATPFVLPQRAEPWPRPHARDGATA
LRTATVSSFGAGGANAHLIVEEYRDDAAAEPAASGAALVPLSARTAAQLRRKAAELGDFL
AGDGAGYDLRAVAHTLQSGREAMPHRLAVLAESLPQLTQALRAYGAGEAVEAVCFEGHAD
GGPDGLARLGQDEDMAAAIARWIARGKLAKL