Protein Info for PS417_03805 in Pseudomonas simiae WCS417

Annotation: D-amino acid oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 6 to 6 (1 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details PF01266: DAO" amino acids 7 to 347 (341 residues), 248.3 bits, see alignment E=1.8e-77 PF00890: FAD_binding_2" amino acids 7 to 212 (206 residues), 43.8 bits, see alignment E=2.1e-15 TIGR02352: glycine oxidase ThiO" amino acids 7 to 350 (344 residues), 275 bits, see alignment E=4.5e-86

Best Hits

Swiss-Prot: 80% identical to GLYOX_PSEPK: Glycine oxidase (thiO) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03153, glycine oxidase [EC: 1.4.3.19] (inferred from 94% identity to pfs:PFLU0777)

Predicted SEED Role

"Glycine oxidase ThiO (EC 1.4.3.19)" in subsystem Thiamin biosynthesis (EC 1.4.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4I4 at UniProt or InterPro

Protein Sequence (369 amino acids)

>PS417_03805 D-amino acid oxidase (Pseudomonas simiae WCS417)
MAEQQQVVIVGGGVIGLLTAFNLATQGQAVVLLERAGLGQESSWAGGGIVSPLYPWRYSP
AVTALAHWSQDFYPQLAQRLFAQTGVDPEVHTTGLYWLDLDDEAEALAWAAREGRPLSKV
DVSAAHDAVPVLGGGYANAIYMANVANVRNPRLVKSLKAALLTLPGVTIHEQCEVTGFLL
DAGNVVGVSTADGAIFGDQVVLAAGAWSGELLGTLGLSLPVEPVKGQMILYKCASDFLSS
MVLAKGRYAIPRRDGHILIGSTLEHEGFDKTPTETALESLKASAVELIPALADAEVVGHW
AGLRPGSPEGIPYIGQVPGFKGLWLNCGHYRNGLVLAPASCQLFTDLLLERAPIIDPAPY
APEGRINAG