Protein Info for GFF745 in Sphingobium sp. HT1-2

Annotation: Non-heme chloroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00561: Abhydrolase_1" amino acids 25 to 256 (232 residues), 104.7 bits, see alignment E=1.4e-33 PF12146: Hydrolase_4" amino acids 26 to 124 (99 residues), 48.6 bits, see alignment E=1.4e-16 PF12697: Abhydrolase_6" amino acids 26 to 268 (243 residues), 74.9 bits, see alignment E=3.1e-24

Best Hits

Swiss-Prot: 63% identical to PRXC_PSEFL: Non-heme chloroperoxidase (cpo) from Pseudomonas fluorescens

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 85% identity to atu:Atu3463)

Predicted SEED Role

"Non-heme chloroperoxidase"

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF745 Non-heme chloroperoxidase (Sphingobium sp. HT1-2)
MSNFVTTQDGTRIFYKDWGPRDGQPILFSHGWPLSADAWDAQMVYFANQGFRTIAHDRRS
HGRSDQVWDNNNMDQYADDLADLVEALDLSDVILVGHSTGGGEVTRYIGRHGTSRVAKLA
LIGAVPPLMLKTEANPGGLPIDVFDGIRKGTFDNRSQFFRDLTIPFYGYNRDGAVISEGI
VQEFWRQGMMGGLKGQLDSIRAFSESDFHADLAKVDVPTLVLHGDDDQIVPIGAAALSTV
KIVTDAVLIVYEGADHGLTQTHQDRFNADLLDFING