Protein Info for GFF7427 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 14 to 50 (37 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 103 to 327 (225 residues), 69.6 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 87% identity to vpe:Varpa_1322)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF7427 ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MDLQIALLLGQDGIVNGAVYGLMALALVLVFSVTRVIFIPQGEFVAFGALSMAALQGGRA
PSTLWLLLALAAIVLVVEAWRWKRGATVDWRSALTWCVAFPAVAAVLILGFKPTSLAMQS
LATLVLIAPLGPLLYRVAYRPLADASVLMLLIVSVALHGVLVGLGLFFFGAEGSRTSAFS
EARFDLGGIPVNGQSLVVVGVTLVLVIAMFWFFGRSMIGKALRATAINRVGARLSGIPTE
LSGDLSFALAAVIGAISGLLIAPITTVYYDTGFLIGLKGFVAAIVGGLASYPLALAGALL
VGLLEAFSSFWASAYKEVLVFTLIIPVLLWRSLNSHHVEDEE