Protein Info for GFF7421 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 100 to 127 (28 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 199 to 225 (27 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details PF07690: MFS_1" amino acids 1 to 342 (342 residues), 145.5 bits, see alignment E=9.9e-47 amino acids 205 to 376 (172 residues), 39.1 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: K13021, MFS transporter, ACS family, tartrate transporter (inferred from 45% identity to rpc:RPC_4631)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>GFF7421 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MNKDLGLSATAFGLAVGMFSLGYFFFEIPSMLMLRRVGARRWLARIMISWGVLSLATAFV
RTEASLYVVRFLIGAAEAGFVPGVLYYLTRWIPAAQRGRVIGIFMLGVPMATIVGSPISG
LLLGINWFGLQGWQWLFIVEAVPSILLGISILYVLPEKPADVDWLTPGNKAWLQRELDQE
HARAAALGRSKLMSALTSPIVLVLGLIYLGNGVGLFGAAAFMPLIIRELGLSYAATGWSM
SFVYVLMAVWMIFWTRHSDKTGERIWHVAGASLLGVACLVVAALYAHSPVIAVVWLGLSA
ILMNPATPSFWNLPPKYLSGAGAAAGIALISSIGALGAFIGPLVLGFAKDHFGGYSGGLL
LIALGPLLSAVLTLALKRHKAFARQA