Protein Info for GFF7420 in Variovorax sp. SCN45

Annotation: Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF22290: DmmA-like_N" amino acids 98 to 214 (117 residues), 49.1 bits, see alignment E=1.2e-16 PF00175: NAD_binding_1" amino acids 114 to 203 (90 residues), 31.5 bits, see alignment E=3.5e-11 PF00111: Fer2" amino acids 241 to 310 (70 residues), 43.7 bits, see alignment E=3.3e-15

Best Hits

Swiss-Prot: 56% identical to VANB_PSEPU: Vanillate O-demethylase oxidoreductase (vanB) from Pseudomonas putida

KEGG orthology group: K03863, vanillate monooxygenase [EC: 1.14.13.82] (inferred from 62% identity to pna:Pnap_2724)

MetaCyc: 53% identical to vanillate O-demethylase reductase component (Pseudomonas sp. HR199)
Vanillate monooxygenase. [EC: 1.14.13.82]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-, 1.14.13.82

Use Curated BLAST to search for 1.14.13.- or 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF7420 Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-) (Variovorax sp. SCN45)
MTTTPSLTVRVERKTREATDILGFDLVGIDGEMLPAFSAGSHIDLMLPNGITRQYSLCNP
PTERRRYSIAVLREPASRGGSKALHDAVHEGDTLVISPPRNHFALAHGAKRHLLLAGGIG
ITPILCMADRLAATGEHFDLHYCARSEERMAFRERVQAFSERATLHLDDGDAVQRLDFAS
LLAQPEPGTHLYVCGPKGFMDAVLEAARHSSWKEECLHYEFFSGAAINTDSDSEFDVRLA
STGQVIAVARGTSVTEALLCAGIKVNTSCEQGVCGSCLTRVLEGTPDHRDLYLTPDEQQK
NDQFTPCCSRSKSKVLVLDL