Protein Info for GFF7408 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 62 to 84 (23 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 173 to 201 (29 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF12911: OppC_N" amino acids 52 to 89 (38 residues), 36.8 bits, see alignment 2.8e-13 PF00528: BPD_transp_1" amino acids 142 to 324 (183 residues), 105 bits, see alignment E=4.2e-34

Best Hits

Swiss-Prot: 34% identical to DPPC_HAEIN: Dipeptide transport system permease protein DppC (dppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 78% identity to put:PT7_1964)

Predicted SEED Role

"ABC-type dipeptide/oligopeptide/nickel transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF7408 ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MSTPFTLDSAIANPPVPAPAPAAVRRTEEPAAPAVKAVRAAVDAKPVSSRHAALRAFLRN
PAAVAGVVLLVCMLILALLAPLLYPGDPLDMVAPPLLWPGQDAAYPLGSDSLGRDVIAGI
AHGARVSLAVGVVAAVLSLVIGVLVGATAGYFGGRIDDVLVRITELFQTMPSFLFVIVVV
AIGQPSVPVIVCAIGLASWPVIARLVRAEFRALRETEFVLAARSQGFSHARIIFQEMLPN
ALPPVIVTTSVLVASAILIESALSFLGMGDPNAVSWGSMIGQGRELLRTAWYLTALPGAA
IVLTVLALNLVGDGLNDAFNPRLRGR