Protein Info for GFF7407 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 8 to 79 (72 residues), 25.8 bits, see alignment E=1.1e-09 PF00528: BPD_transp_1" amino acids 120 to 325 (206 residues), 142.3 bits, see alignment E=1.5e-45

Best Hits

Swiss-Prot: 40% identical to Y1031_BRUAB: Putative peptide transport system permease protein BruAb2_1031 (BruAb2_1031) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 73% identity to put:PT7_1965)

MetaCyc: 40% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF7407 ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MKLRSASRTLVRTAWQAVPTVIGVILLNFILMQLIPGDAADVVAAESGSATAESMAQLRT
HFGLDLPVIQQLFAYLNNLAHFSLGISPRYNMPVVSLIGARLGNTLLLMVTALAFALAIG
IAAGTVMATRVGRWQDRTLSVLALLLYSTPGFWLGLMAIVLFSVHLGWLPTGGSESIGAG
YTGWTHVVDVARHLVLPALAMAGFYIAIFSRLTRAAMLEVSRQDFVRTAEAKGLHPWTVN
LRHILRNALIPVTTVAGMHFGTLLGGAVVVETVFSWPGLGRLAFDSVAGRDYTVLLGVLL
MSSLLVIVANMLVDLLHAWLDPRIQVR