Protein Info for GFF7400 in Variovorax sp. SCN45

Annotation: Type I secretion system ATPase, LssB family LapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 transmembrane" amino acids 161 to 183 (23 residues), see Phobius details amino acids 195 to 212 (18 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 9 to 702 (694 residues), 822.7 bits, see alignment E=1.2e-251 PF00664: ABC_membrane" amino acids 162 to 426 (265 residues), 109.1 bits, see alignment E=3.4e-35 PF00005: ABC_tran" amino acids 494 to 640 (147 residues), 96.9 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 80% identity to vpe:Varpa_5038)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (705 amino acids)

>GFF7400 Type I secretion system ATPase, LssB family LapB (Variovorax sp. SCN45)
MKLSSQYTSWLDAMLFVARHYGIGASEESVRVSLAWERGAPLDTLLDHMARQLGLTVRLG
EFSDAMLDPWRLPLVVEFDNGEVGVVRASDGHGQLGVLLGGDHGLETALPLAELRLHAKR
VAVLRPNTAVPDARVDDYIKPYKANWFWAIALRDWRRYGDIVLASMFANVLALASMIFSM
QIYDRVVPAQSEPTLWVLFGGVMLAVVFEFMLRVSRTHISDVIGKRADLKVSDVVFGHAL
RLRTDARSKSTGSFIAQVREVEQVRELLTSTTISAVADLPFFLLFLVVLWLVAGPLALVA
LAAVPLLVIPGLLIQKPLARLASEGMRESALRNALLVEAVEGIEDIKLMRAEPRFQNQWN
HVNDVSAGVSMRQRFLTSLLMTWTQEVQTIVYAVVLLAGCFLVMRGDMTTGALVGSSILA
SRMISPLAQLSGVFARWQQAKVARAGLDQLMQRPVDQADGARLVHAPALHGNYALAGVEF
RYGKEDKSPALTIAQLQIQAGDKVALLGRMGSGKSTLLQLLAGLQSPQQGHVALDALDLS
LIDPADLRRDMGLLTQNARLFHGSIRENVTMGMPLATDDQVFEAVAMAGALSFLQSRAEG
LDELIHEGGLGLSGGQRQALLLARTLIRQPSIVLLDEPTAHFDEVTERHVIDSMGAWLGP
RTLVVATHRMPVLQWVDRIVVIDGGRIVMDGSKDQVLGRLSHGNA