Protein Info for GFF7396 in Variovorax sp. SCN45

Annotation: Tryptophan halogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details PF04820: Trp_halogenase" amino acids 11 to 470 (460 residues), 376.1 bits, see alignment E=2.7e-116

Best Hits

Swiss-Prot: 48% identical to Y4XG_SINFN: Uncharacterized protein y4xG (NGR_a00820) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K14266, FADH2 O2-dependent halogenase I [EC: 1.14.14.7] (inferred from 48% identity to rhi:NGR_a00820)

Predicted SEED Role

"Tryptophan halogenase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>GFF7396 Tryptophan halogenase (Variovorax sp. SCN45)
MLNLRGISRAVVIGGGTAGWFAALTLRRMFSSQVEIRVIESPDIGIVGVGEGGLLNLVDA
LRRNGIDLDEFVRETGAAFKLGFSYEGWRTGAEDDRYYHLFGRPGLPETDWVERGFHPLF
SGMVHEGIELHRYIPGFAEIASNATQQEAAAMLRHGPVSGLSASFHFDSHKLADYLRRVA
VSRGVVHQQARVEELVCDEQRLARSLRLDNGESIDLDLLIDASGLARLGIGKKLGVRWRS
FSEHLLLDRAVPFHMPHPQPNPSLVTRAIAMPAGWMWQIPLVERVGAGYVFSSAHTDETQ
VIDEIHRRIGPKVEPMRTLRFEPGHFEQVWVGNIMAIGLASGFVEPLEATSIGQMLEQLR
NFERIVTASNGVVSGYLIEGFNEANARCWSGIRDFLRMHYDCPRRDTAFWRDVAALPLPP
GYAELKQCFQQRTPRLIDVENYAMHGWQGIFHVINWLFVAAPLGVVPPEAAAFELASLPA
VSRRRVATRVSELRKSSVPG