Protein Info for GFF7381 in Variovorax sp. SCN45

Annotation: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 179 to 199 (21 residues), see Phobius details PF03446: NAD_binding_2" amino acids 2 to 164 (163 residues), 173.3 bits, see alignment E=6.3e-55 PF03807: F420_oxidored" amino acids 2 to 68 (67 residues), 27.6 bits, see alignment E=5.6e-10 TIGR01692: 3-hydroxyisobutyrate dehydrogenase" amino acids 5 to 294 (290 residues), 421.1 bits, see alignment E=1.2e-130 PF14833: NAD_binding_11" amino acids 167 to 293 (127 residues), 105.4 bits, see alignment E=3.6e-34

Best Hits

Swiss-Prot: 64% identical to MMSB_PSEAE: 3-hydroxyisobutyrate dehydrogenase (mmsB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 99% identity to vpe:Varpa_2391)

MetaCyc: 54% identical to 3-hydroxyisobutyrate dehydrogenase subunit (Pseudomonas putida)
3-hydroxyisobutyrate dehydrogenase. [EC: 1.1.1.31]

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF7381 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (Variovorax sp. SCN45)
MKIAFIGLGNMGGPMAMNLLKAGHTLSAFDLSAEACKKFGAEGLPIAKSAAETVADAEVV
ISMLPASAHVEGLFLGGAGKPGLLESIKAGTLVIDSSTIAAATSRKVAEAAAAKGVAMID
APVSGGTGGAIAGTLTFMVGGETKDLERARPVLEKMGANIFHAGAAGAGQTAKICNNMLL
GILMIGTSEALALGVANGLDPKVLSEIMRRSSGGNWALEKYNPMPGVMETSPASKNYAGG
FGTDLMLKDLGLAQENAAAVRAATPLGGLARSLYAAHSLAGHGALDFSSVLKLVQKS