Protein Info for GFF737 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Autolysin sensor kinase (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details PF06580: His_kinase" amino acids 171 to 249 (79 residues), 89.2 bits, see alignment E=8.7e-30

Best Hits

KEGG orthology group: K08082, two-component system, LytT family, sensor histidine kinase AlgZ [EC: 2.7.13.3] (inferred from 63% identity to rfr:Rfer_1711)

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>GFF737 Autolysin sensor kinase (EC 2.7.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLPMKDSRILSSFQELAHAAGARPIAEMPEDLRVRVQVFDTCQVGTVLRAVLFVQAIVSV
AALFGAQTFVAWITQLAIYTGAALPAVLAWLLTVCGLKRQLGLLPMPGQWAAAIGFGALS
GLYGCGLLVWMGLAEPSPWLASAASGALVSAVLVAALMWRSKARGPAGATARLAELQARI
RPHFLFNTLNSAIALVREEPAKAENLLEDLSELFRHALADAKEAVPLWQELELAEHYLAI
EQVRFGERLKVEWSVDEAASKAKLPPLILQPLVENAVKHGVEPSASGAVVRISTQRRGSV
VVIKVTNTVPAGSGRPGNGLALDNVRQRLTLLHDVQGRFQSALVNGVFQVRLEIPV