Protein Info for GFF7358 in Variovorax sp. SCN45

Annotation: Phenylacetate ABC transporter, permease protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 85 to 85 (1 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 296 (262 residues), 151.5 bits, see alignment E=1.3e-48

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 54% identity to rpx:Rpdx1_4280)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>GFF7358 Phenylacetate ABC transporter, permease protein 2 (Variovorax sp. SCN45)
VRSRGVARPRPLASLLLLAAVIVLLPFVFTANFHLRVIVLVWIYSLAAIGLNLMMGYGGQ
VSLGHGAFLAIGAYAVAVGSSRWGLSPAVTLPGGVLVSAALAFVVGRPILRLKGHYLAVG
TLGFGVLVFMALTNQVAWSGGPDGMQVVRRALFGWDMRGNIFWYALTGSLLMIGAWIALN
LANSPTGLALRALRDSEIASSSLGVDIARQKLFVFVLSACYASVAGSLIALFNGHVTPGL
SDFMVSVQLVTMVVLGGMGSVLGSVVGAALLVLLPQVLSSLHDYEQAFIGFVMVASAIFL
RAGIVPSLARALQSRNRHDITS