Protein Info for GFF7345 in Variovorax sp. SCN45

Annotation: Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00111: Fer2" amino acids 52 to 102 (51 residues), 40.7 bits, see alignment E=1.9e-14 PF01799: Fer2_2" amino acids 119 to 206 (88 residues), 98 bits, see alignment E=2.8e-32

Best Hits

Swiss-Prot: 62% identical to PAOA_ECO57: Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA (paoA) from Escherichia coli O157:H7

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 75% identity to vap:Vapar_5490)

MetaCyc: 62% identical to aldehyde dehydrogenase, Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF7345 Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT (Variovorax sp. SCN45)
MTSHDALQISRRGLLKAGAASATVPALAGTSTAGAATARTTGTPAATPVSLIVNGRQQQL
VLDTRTTLLDALREHLHLTGTKKGCDHGQCGACTVMVDGRRINSCLTLAVMHEGGNVVTI
EGLGQPGHLHPMQAAFVKHDGYQCGYCTPGQICSAVGMLHEIDQGVPSHVSGDLTARPLL
SPAELRERMSGNICRCGAYSNIVDAITEVAGGNAGAKA