Protein Info for GFF7310 in Variovorax sp. SCN45

Annotation: tRNA-(cytosine32)-2-thiocytidine synthetase TtcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF01171: ATP_bind_3" amino acids 52 to 215 (164 residues), 51.4 bits, see alignment E=5.7e-18

Best Hits

Swiss-Prot: 94% identical to TTCA_VARPS: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 93% identity to vpe:Varpa_1034)

MetaCyc: 66% identical to tRNA cytosine32 2-sulfurtransferase TtcA (Escherichia coli K-12 substr. MG1655)
2.8.1.M2 [EC: 2.8.1.M2]

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF7310 tRNA-(cytosine32)-2-thiocytidine synthetase TtcA (Variovorax sp. SCN45)
MNAVWIDEAPAAADATANSLKIERETHKLEKRLCRQVGQAIVDYNMIEEGDKVMVCVSGG
KDSYALLDILLKLKARAPIHFDIVAVNLDQKQPGFPEEVLPKYLSDLGVDFHIENQDTYS
IVKRVIPEGKTTCGLCSRLRRGILYRVADELGATKVALGHHRDDMLQTFFLNMFFAGKLK
SMPPKLVSDDGKHIVIRPLAYVAEKDTVRWAQHREFPIIPCTLCGSQENLQRKQVGEMLR
EWDKKYPGRVENMFTALQNVVPSHLLDGTRHDFKGLKATGVADDDGDKAFDTPSFDLLSQ
APSALRIVQG