Protein Info for GFF73 in Variovorax sp. SCN45

Annotation: Probable haloacid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF13419: HAD_2" amino acids 14 to 181 (168 residues), 48.1 bits, see alignment E=1.5e-16 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 14 to 174 (161 residues), 45 bits, see alignment E=1.3e-15 PF00702: Hydrolase" amino acids 45 to 164 (120 residues), 56.3 bits, see alignment E=6e-19 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 74 to 158 (85 residues), 23.4 bits, see alignment E=6.9e-09

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_2205)

Predicted SEED Role

"probable haloacid dehalogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>GFF73 Probable haloacid dehalogenase (Variovorax sp. SCN45)
MQTPIAPPRYPRAVLFDLLTALLDSWTVWNAAAGSEEKGRAWRAEYLRLTYGCGAYVPYE
QLVKDAARNTGMAVTAPDALEAQWDTLPAWDGARELLQALKPHCKLGVATNCSRRLGHRA
AALLGIEWDAVVTSEEAGFYKPDPRPYRMALERMGVTPQESAFVAGSGYDMFGTSVVGLR
TYWHNRVGLALPPGAPAPELQGPTLAPALPWLQSFTNKA