Protein Info for GFF7297 in Variovorax sp. SCN45

Annotation: Outer membrane beta-barrel assembly protein BamE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF04355: BamE" amino acids 49 to 117 (69 residues), 87.6 bits, see alignment E=2e-29

Best Hits

KEGG orthology group: K06186, small protein A (inferred from 83% identity to vap:Vapar_0407)

Predicted SEED Role

"Outer membrane lipoprotein SmpA, a component of the essential YaeT outer-membrane protein assembly complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>GFF7297 Outer membrane beta-barrel assembly protein BamE (Variovorax sp. SCN45)
MPAILQRRPWLLVAAIAATLGLGACSGFSERTRVALTAVTPYKVEVVQGNFVSKEQVAAL
KPGMSRQQVREILGTSLLSDVFHNNRWDYVFTIRRQGVEPQERHLTVFFNGELMDRFEGD
EMPSEQDFVATLDTRKKSSKVPTLEASEDDLKKFAPSKDEKKADSATSSPSASLPPLPAA
YPPLEAAR