Protein Info for GFF7272 in Variovorax sp. SCN45

Annotation: D-glucarate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 77 to 127 (51 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 275 to 301 (27 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 367 to 393 (27 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 382 (367 residues), 186.6 bits, see alignment E=6.4e-59 TIGR00893: D-galactonate transporter" amino acids 23 to 421 (399 residues), 397 bits, see alignment E=4.5e-123

Best Hits

Swiss-Prot: 51% identical to GUDP_BACSU: Probable glucarate transporter (gudP) from Bacillus subtilis (strain 168)

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 52% identity to avn:Avin_05240)

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>GFF7272 D-glucarate permease (Variovorax sp. SCN45)
MFTHRKRFLILALITVVLAFSTGDRATLSVAGSGMAKELQLSPVQMGWLFSSFAWAYVLA
HIPAGWLVDRLGAKRTVVIGLVLWSICTALQGAAAWFGSVFATLIALRFLMGVFEAPVGP
ASGRVIAMWFPSGERGVAGAIFNSAQYLSLAVFTPLMGWLDHRFGWEHVFSVMGGLGLLL
AVVWYAWFHVPATHPSLSAQELDSIRAGGALTDLNARQTSVRKDPDAPGILDLFRSRMLS
GIFLAQYCITAITWFFVSWFPTYLVKERGFSILNAGFIASLPAIAGFIGGVSTGFVTDWL
LRRTGSLTIARKIPITIGLLLTASMIGCNFVDADWMVIGLMSLAFFGKGFGSLGWTVVAD
TAPKELIGLTGGVFNAIGNTAGITTPLVIGYILGATNSFHYALVFVGLHGLVAVMSYWLI
VGKIERFNVRSRRRSGNANEVIDGTPAVR