Protein Info for GFF7271 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00356: LacI" amino acids 1 to 45 (45 residues), 55.2 bits, see alignment 9.8e-19 PF00532: Peripla_BP_1" amino acids 59 to 270 (212 residues), 65.3 bits, see alignment E=1.3e-21 PF13407: Peripla_BP_4" amino acids 60 to 253 (194 residues), 48.3 bits, see alignment E=2.1e-16 PF13377: Peripla_BP_3" amino acids 167 to 323 (157 residues), 91.3 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 44% identity to pol:Bpro_4527)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF7271 Transcriptional regulator, LacI family (Variovorax sp. SCN45)
MSDVAAAAGVSLVTVSRCINQPDKVTPETLALVRAAVERLGYVPNLTAGSLASNRSRIVA
AIVPTISNSVFSEMVEALASTLSAGGYQLLLGQSSYRADDEERLVDAFLGRRVDGLVLTG
APRAEQLAQRLRRNGLPVVQTWDLPLRPIDMAVGFSNFDTGMAAGRFLAGKGRRRIGFLG
ASEDRAAQRLAGLRAALADAGLLPPEVETLPPPVLVDKAGPGLSAMLERAPDLDAIFCNN
DLLAAGVLFECQRRAVRVPDDLAVLGFGDLPIGTAAFPALSTIRIGLRGMGEQAGRLLLA
RFAGEGNLPGLTDLGFEVVQRDSA