Protein Info for GFF727 in Xanthobacter sp. DMC5

Annotation: Lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00510: lipoyl synthase
  • amino acids 16 to 307 (292 residues), 371.9 bits, E=1.2e-115
• PF04055: Radical_SAM
  • amino acids 77 to 240 (164 residues), 66.9 bits, E=1.3e-22

Best Hits

Swiss-Prot: 92% identical to LIPA_XANP2: Lipoyl synthase (lipA) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 92% identity to xau:Xaut_3897)

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Protein Sequence (317 amino acids)

>GFF727 Lipoyl synthase (Xanthobacter sp. DMC5)
MVTVIDTRERPRHPEKAHRPETEVLRKPDWIRVKAPGSAGWSKTAGIVKEHGLVTVCEEA
GCPNIGECWEKKHATFMIMGDTCTRACAFCNVRTGLPDALDRDEPQKVADSIAKLGLSHA
VITSVDRDDLADGGAEHFARTIAAIRKASPSTTIEILTPDFLRKDGALEVVVAARPDVFN
HNLETVPSRYLSVRPGARYFHSLRLLQKVKELDPSIFTKSGIMVGLGEERPEVLQLMDDL
RSADVDFITIGQYLQPTRKHHKVERFVTPDEFKAYETVAYAKGFLMVSASPLTRSSHHAG
DDFEKLRANRAARLGRA