Protein Info for GFF7265 in Variovorax sp. SCN45

Annotation: hypothetical protein, not 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10282: Lactonase
  • amino acids 28 to 339 (312 residues), 204.5 bits, E=4.3e-64

Best Hits

KEGG orthology group: K07404, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 46% identity to psb:Psyr_2494)

MetaCyc: 48% identical to D-galactaro-1,5-lactonase/D-glucaro-1,5-lactonase (Pseudomonas syringae)
3.1.1.M28 [EC: 3.1.1.M28]; 3.1.1.M28 [EC: 3.1.1.M28]

Predicted SEED Role

"hypothetical protein, not 6-phosphogluconolactonase"

MetaCyc Pathways

• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• heterolactic fermentation (15/18 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• D-galacturonate degradation III (2/2 steps found)
• D-glucuronate degradation III (2/2 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.31

Use Curated BLAST to search for 3.1.1.31 or 3.1.1.M28

Protein Sequence (370 amino acids)

>GFF7265 hypothetical protein, not 6-phosphogluconolactonase (Variovorax sp. SCN45)
MQSLKPLVLLAIASLGAASHAGTFAYVSNAEDGTISSYRIDAAGGTLQPLATTPTGKLVM
PLALSPDGRHLYASVRSQPYSVVTYRIDARSGALDRLATANLPDSMAYISSDRGGRYLFG
ASFGGDVISVNPIGPNGVAQGETLQLIKTGRHAHSIVVDPSNRFVYVGNLGVHRVLQFAF
DEHSGALAPIDAGFAPAEAGSGPRHSAPSPNGNFLYVLSELFGSVTTYAIDRKTGALSAK
GSFDGVPAARYKLEKGLIRPPLGQGEKVDDTPRIWAADIKVSPDGRFVYTTERTSSTVTS
YRADPVTGALSYQATIEVEKQPRGIAIDPRGRWLVVTGERVLRWVFMPSIRSPVLSSASP
VRRLAKVPTG