Protein Info for GFF7252 in Variovorax sp. SCN45

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF13276: HTH_21" amino acids 45 to 100 (56 residues), 39.8 bits, see alignment E=6.5e-14 PF00665: rve" amino acids 116 to 211 (96 residues), 60.5 bits, see alignment E=2.5e-20 PF13683: rve_3" amino acids 200 to 262 (63 residues), 86.1 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 42% identical to YI71_BURM1: Insertion element IS407 uncharacterized 31.7 kDa protein (Bmul_4719) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: None (inferred from 69% identity to bgl:bglu_1g07840)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF7252 Mobile element protein (Variovorax sp. SCN45)
MVSPLARREQLAFVRARGLSLRRACGLIGMSRATPSYELRLPAKDAPVLAAMKELSAQYP
RYGYRRIRVFLRRKGFELSWSRTHRLWRQAGLLVPRKRPRKRIASVRPRVHTPFKANMVW
AYDFVFDTTASGQQIKCLTVVDEYTRECLAIDVAGAIRSKRVIEVLSRLVSLHGAPLFMR
SDNGTEFVSQAILEWISGAGIATVLNDPGKPWQNGTDESFNGKFRDECLSIEWFRSRREA
AVLIEAWRNHYNEVRPHSSLNRPGFHGGQLV