Protein Info for GFF725 in Xanthobacter sp. DMC5

Annotation: Dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 5 to 471 (467 residues), 582.6 bits, E=2.8e-179
• PF07992: Pyr_redox_2
  • amino acids 5 to 332 (328 residues), 238.9 bits, E=3.7e-74
• PF12831: FAD_oxidored
  • amino acids 6 to 41 (36 residues), 32.7 bits, 2.4e-11
• PF01134: GIDA
  • amino acids 6 to 66 (61 residues), 28.2 bits, E=4.7e-10
• PF00890: FAD_binding_2
  • amino acids 6 to 43 (38 residues), 29.8 bits, 1.7e-10
• PF13450: NAD_binding_8
  • amino acids 9 to 43 (35 residues), 22.1 bits, 7e-08
• PF13738: Pyr_redox_3
  • amino acids 138 to 316 (179 residues), 37.1 bits, E=1e-12
• PF00070: Pyr_redox
  • amino acids 182 to 257 (76 residues), 72.2 bits, E=1.9e-23
• PF02852: Pyr_redox_dim
  • amino acids 352 to 460 (109 residues), 129.3 bits, E=3.4e-41

Best Hits

Swiss-Prot: 70% identical to DLDH_RHIEC: Dihydrolipoyl dehydrogenase (lpdA) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 95% identity to xau:Xaut_3894)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (2/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (471 amino acids)

>GFF725 Dihydrolipoyl dehydrogenase (Xanthobacter sp. DMC5)
MADTYDIIVIGGGPGGYVAAIRAAQLGFKTAVVEKSHLGGICLNWGCIPTKALLRSAEIY
HYMEHAKDYGLSAEKIGFDAAAVVKRSRGVSSQLATGVGFLLNKNKVDVIWGKATFTAPG
KLKVEAAQNPPKNAKGGGDYTAKHIIVATGARPRALPGLEPDKKLIWTYFEAMVPEKMPK
SLLVMGSGAIGIEFASFYRTMGVDVTVVEVLPQILPVEDEEIAAIARKRFEKQGMKIMSG
AKVTGVTKHADSLTAHVEDAKGAKHDITVDRMISAVGVVGNVEGLGLEAIGVKIERGIVV
TDGLGRTNVPGVYAIGDIAGPPMLAHKAEHEGVICVETIKGLHTHPMDKNKIPGCTYCTP
QIASVGLTEKKAKEAGREIKVGRFPFIGNGKAIALGEPDGLVKTIFDAKTGELLGAHMVG
AEVTELIQGFVVAMNLETTEEDLIHAVFPHPTLSEMMHESVMAAYGRAIHV